Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant BK polyomavirus Agnoprotein, partial, Biotinylated

This Recombinant BK polyomavirus Agnoprotein, partial, Biotinylated spans the amino acid sequence from region 1-35aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Agno

UniProt

P14998

Expression Region

1-35aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

BK polyomavirus (strain AS) (BKPyV)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFCEPKNLVVLRQLSRQASVKVGKTWTGTKKRAQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Involucrin (IVRN/827), CF405S conjugate, 0.1mg/mL
BNC040827-100 1x 100 µL

Involucrin (IVRN/827), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1B (NM_001764) Human Over-expression Lysate
LY419761 100 µg

CD1B (NM_001764) Human Over-expression Lysate

Sign In for Pricing
View Details
Sell Rat Monoclonal Antibody [Clone ID: MEL-14]
CL032RX 300 µg

Sell Rat Monoclonal Antibody [Clone ID: MEL-14]

Sign In for Pricing
View Details
Fmoc-L-azidoalanine
TRC-F619935-50MG 50 mg

Fmoc-L-azidoalanine

Sign In for Pricing
View Details
RPS4Y1 Human Gene Knockout Kit (CRISPR)
KN401553 1 Kit

RPS4Y1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Pdss1 activation kit by CRISPRa
GA205827 1 Kit

Mouse Pdss1 activation kit by CRISPRa

Sign In for Pricing
View Details