Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant BK polyomavirus Agnoprotein, partial, Biotinylated

This Recombinant BK polyomavirus Agnoprotein, partial, Biotinylated spans the amino acid sequence from region 1-35aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Agno

UniProt

P14998

Expression Region

1-35aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

BK polyomavirus (strain AS) (BKPyV)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFCEPKNLVVLRQLSRQASVKVGKTWTGTKKRAQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pirlimycin Hydrochloride
TRC-P509305-1MG 1 mg

Pirlimycin Hydrochloride

Sign In for Pricing
View Details
1,2-Benzenedicarboxylic Acid Di-C6,8,10-alkyl Esters(1:1:1 Mixture of D446490 and D481750 and D439395, by weight)
TRC-B185520-250MG 250 mg

1,2-Benzenedicarboxylic Acid Di-C6,8,10-alkyl Esters(1:1:1 Mixture of D446490 and D481750 and D439395, by weight)

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799 + KRT19/800), 1mg/mL
BNUM1150-50 1x 50 µL

Cytokeratin 19 (KRT19/799 + KRT19/800), 1mg/mL

Sign In for Pricing
View Details
Laflunimus Sodium Salt
TRC-L168510-50MG 50 mg

Laflunimus Sodium Salt

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3055), CF740 conjugate, 0.1mg/mL
BNC743055-500 1x 500 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3055), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C4 Ceramide-1-phosphate
TRC-C262555-1MG 1 mg

C4 Ceramide-1-phosphate

Sign In for Pricing
View Details