Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 4E type 2 (EIF4E2)

This Recombinant Human Eukaryotic translation initiation factor 4E type 2 (EIF4E2) spans the amino acid sequence from region 1-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EIF-4E type 2; eIF4E type 2; Eukaryotic translation initiation factor 4E homologous protein; Eukaryotic translation initiation factor 4E-like 3; eIF4E-like protein 4E-LP; mRNA cap-binding protein 4EHP; h4EHP; mRNA cap-binding protein type 3

UniProt

O60573

Expression Region

1-245aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2RY11 Antibody
A14978-50UG 50 µg

P2RY11 Antibody

Sign In for Pricing
View Details
Pigeon CUB and Zona Pellucida Like Domains Protein 1 ELISA Kit
MBS053356 Inquire

Pigeon CUB and Zona Pellucida Like Domains Protein 1 ELISA Kit

Sign In for Pricing
View Details
GSK2126458 (PI3K inhibitor)
SF2811-5mg 5 mg

GSK2126458 (PI3K inhibitor)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Spermidine synthase (spe-3)
MBS1387658-01 0.02 mg (E-Coli)

Recombinant Neurospora crassa Spermidine synthase (spe-3)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Spermidine synthase (spe-3)
MBS1387658-02 0.02 mg (Yeast)

Recombinant Neurospora crassa Spermidine synthase (spe-3)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Spermidine synthase (spe-3)
MBS1387658-03 0.1 mg (E-Coli)

Recombinant Neurospora crassa Spermidine synthase (spe-3)

Sign In for Pricing
View Details