Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Actin-binding LIM protein 1 (Ablim1), partial

This Recombinant Mouse Actin-binding LIM protein 1 (Ablim1), partial spans the amino acid sequence from region 90-345aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AbLIM-1; Actin-binding LIM protein family member 1

UniProt

Q8K4G5

Expression Region

90-345aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMSSSPKEASCSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANCE Protein Vector (Mouse) (pPM-C-HA)
20233024 500 ng

FANCE Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal IL-2 R beta Antibody (27302) [DyLight 755]
FAB224Z 0.1 mL

Mouse Monoclonal IL-2 R beta Antibody (27302) [DyLight 755]

Sign In for Pricing
View Details
Tissue Plasminogen Activator (tPA) Monoclonal Antibody
CAU33719-01 100 µL

Tissue Plasminogen Activator (tPA) Monoclonal Antibody

Sign In for Pricing
View Details
Tissue Plasminogen Activator (tPA) Monoclonal Antibody
CAU33719-02 200 µL

Tissue Plasminogen Activator (tPA) Monoclonal Antibody

Sign In for Pricing
View Details
Tissue Plasminogen Activator (tPA) Monoclonal Antibody
CAU33719-03 1 mL

Tissue Plasminogen Activator (tPA) Monoclonal Antibody

Sign In for Pricing
View Details
3-Chloro-5-phenylpyrazolo[1,5-a]pyrimidine-7-carboxylic acid
LQB36625-01 100 mg

3-Chloro-5-phenylpyrazolo[1,5-a]pyrimidine-7-carboxylic acid

Sign In for Pricing
View Details