Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein AF-9 (MLLT3), partial

This Recombinant Human Protein AF-9 (MLLT3), partial spans the amino acid sequence from region 1-138aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ALL1-fused gene from chromosome 9 protein; Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein; YEATS domain-containing protein 3

UniProt

P42568

Expression Region

1-138aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLB1L3 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-8409R-PE-Cy5.5 100 µL

GLB1L3 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
EGLN2 (Egl Nine Homolog 2, Egl Nine Homolog 2 (C. Elegans) )
479969 100 µL

EGLN2 (Egl Nine Homolog 2, Egl Nine Homolog 2 (C. Elegans) )

Sign In for Pricing
View Details
C19orf38 Antibody (Center) [APR03584G]
APR03584G-01 50 µL

C19orf38 Antibody (Center) [APR03584G]

Sign In for Pricing
View Details
C19orf38 Antibody (Center) [APR03584G]
APR03584G-02 100 µL

C19orf38 Antibody (Center) [APR03584G]

Sign In for Pricing
View Details
C19orf38 Antibody (Center) [APR03584G]
APR03584G-03 200 µL

C19orf38 Antibody (Center) [APR03584G]

Sign In for Pricing
View Details
C19orf38 Antibody (Center) [APR03584G]
APR03584G-04 400 µL

C19orf38 Antibody (Center) [APR03584G]

Sign In for Pricing
View Details