Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus agalactiae serotype V Phosphate import ATP-binding protein PstB 2 (pstB2)

This Recombinant Streptococcus agalactiae serotype V Phosphate import ATP-binding protein PstB 2 (pstB2) spans the amino acid sequence from region 1-267aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ABC phosphate transporter 2; Phosphate-transporting ATPase 2

UniProt

P63370

Expression Region

1-267aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEYNWDERHIITFPEENSALTTKDLHVYYGEKEAIKGIDMQFEKNKITALIGPSGCGKSTYLRSLNRMNDTIDIARVTGQIMYEGIDVNAQDINVYEMRKHIGMVFQRPNPFAKSIYKNITFAYERAGVKDKKFLDEVVETSLKQAALWDQVKDDLHKSAFTLSGGQQQRLCIARAIAVKPEILLMDEPASALDPIATMQLEETMFELKKNYTIIIVTHNMQQAARASDYTAFFYLGDLIEYDKTNNIFQNAKCQSTSDYVSGRFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stim1 3'UTR Lenti-reporter-Luc Vector
45724084 1.0 µg

Stim1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ZNRF4 sgRNA CRISPR Lentivector (Human) (Target 2)
K2739803 1.0 µg DNA

ZNRF4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MX1 Polyclonal Antibody
MBS128154-01 0.02 mL

MX1 Polyclonal Antibody

Sign In for Pricing
View Details
MX1 Polyclonal Antibody
MBS128154-02 0.1 mL

MX1 Polyclonal Antibody

Sign In for Pricing
View Details
MX1 Polyclonal Antibody
MBS128154-03 5x 0.1 mL

MX1 Polyclonal Antibody

Sign In for Pricing
View Details
Boc-Gly-Phe-Gly-Lys-OH
A-3280.1000 1.0g

Boc-Gly-Phe-Gly-Lys-OH

Sign In for Pricing
View Details