Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus agalactiae serotype V Phosphate import ATP-binding protein PstB 2 (pstB2)

This Recombinant Streptococcus agalactiae serotype V Phosphate import ATP-binding protein PstB 2 (pstB2) spans the amino acid sequence from region 1-267aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ABC phosphate transporter 2; Phosphate-transporting ATPase 2

UniProt

P63370

Expression Region

1-267aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEYNWDERHIITFPEENSALTTKDLHVYYGEKEAIKGIDMQFEKNKITALIGPSGCGKSTYLRSLNRMNDTIDIARVTGQIMYEGIDVNAQDINVYEMRKHIGMVFQRPNPFAKSIYKNITFAYERAGVKDKKFLDEVVETSLKQAALWDQVKDDLHKSAFTLSGGQQQRLCIARAIAVKPEILLMDEPASALDPIATMQLEETMFELKKNYTIIIVTHNMQQAARASDYTAFFYLGDLIEYDKTNNIFQNAKCQSTSDYVSGRFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 Ligase Ligand-linker Conjugate 114
HY-159661 1 Each

E3 Ligase Ligand-linker Conjugate 114

Sign In for Pricing
View Details
Lentiviral human CCNJ shRNA (UAS) - Lentiviral human CCNJ shRNA (UAS) (100)
GTR15314601 1 Vial

Lentiviral human CCNJ shRNA (UAS) - Lentiviral human CCNJ shRNA (UAS) (100)

Sign In for Pricing
View Details
Plectin Rabbit pAb, Cy5 conjugated
orb3000873 100 µL

Plectin Rabbit pAb, Cy5 conjugated

Sign In for Pricing
View Details
Kir7.1 (KCNJ13) (NM_001172416) Human Tagged ORF Clone
RG229522 10 µg

Kir7.1 (KCNJ13) (NM_001172416) Human Tagged ORF Clone

Sign In for Pricing
View Details
GTF3C1 Human shRNA Plasmid Kit (Locus ID 2975)
TL312569 1 Kit

GTF3C1 Human shRNA Plasmid Kit (Locus ID 2975)

Sign In for Pricing
View Details
HEN1 Antibody
E38QA5230 100 µL

HEN1 Antibody

Sign In for Pricing
View Details