Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Microfibrillar-associated protein 2 (Mfap2)

This Recombinant Mouse Microfibrillar-associated protein 2 (Mfap2) spans the amino acid sequence from region 17-183aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MFAP-2; Microfibril-associated glycoprotein 1; MAGP; MAGP-1

UniProt

P55002

Expression Region

17-183aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGQYDLDPLPPFPDHVQYNHYGDQIDNADYYDYQEVSPRTPEEQFQSQQQVQQEVIPAPTPEPAAAGDLETEPTEPGPLDCREEQYPCTRLYSIHKPCKQCLNEVCFYSLRRVYVVNKEICVRTVCAHEELLRADLCRDKFSKCGVMAVSGLCQSVAASCARSCGGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CSNK2B Antibody Picoband®, Dylight594 Conjugate
A03475-1-Dylight594 100 µg

Anti-CSNK2B Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Monkey Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 4 (PPP4R4) ELISA Kit
MBS9366093-01 48 Well

Monkey Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 4 (PPP4R4) ELISA Kit

Sign In for Pricing
View Details
Monkey Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 4 (PPP4R4) ELISA Kit
MBS9366093-02 96 Well

Monkey Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 4 (PPP4R4) ELISA Kit

Sign In for Pricing
View Details
Monkey Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 4 (PPP4R4) ELISA Kit
MBS9366093-03 5x 96 Well

Monkey Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 4 (PPP4R4) ELISA Kit

Sign In for Pricing
View Details
Monkey Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 4 (PPP4R4) ELISA Kit
MBS9366093-04 10x 96 Well

Monkey Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 4 (PPP4R4) ELISA Kit

Sign In for Pricing
View Details
Ekc1 Antibody
orb854089 2 mg

Ekc1 Antibody

Sign In for Pricing
View Details