Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Chloramphenicol acetyltransferase (cat)

This Recombinant Staphylococcus aureus Chloramphenicol acetyltransferase (cat) spans the amino acid sequence from region 1-215aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAT

UniProt

P06135

Expression Region

1-215aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTFNIIKLENWDRKEYFEHYFNQQTTYSITKEIDITLFKDMIKKKGYEIYPSLIYAIMEVVNKNKVFRTGINSENKLGYWDKLNPLYTVFNKQTEKFTNIWTESDNNFTSFYNNYKNDLFEYKDKEEMFPKKPIPENTIPISMIPWIDFSSFNLNIGNNSSFLLPIITIGKFYSENNKIYIPVALQLHHAVCDGYHASLFINEFQDIINKVDDWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin G2 Polyclonal Antibody
bs-25632R 100 µL

Cyclin G2 Polyclonal Antibody

Sign In for Pricing
View Details
Goat Super Oxidase Dimutase (SOD) ELISA Kit
QY-E140131 96 Tests

Goat Super Oxidase Dimutase (SOD) ELISA Kit

Sign In for Pricing
View Details
Rat CD44 Alexa Fluor 488 MAb (Clone 740017)
FAB6577G 100 Tests

Rat CD44 Alexa Fluor 488 MAb (Clone 740017)

Sign In for Pricing
View Details
SS Agar (Salmonella Shigella Agar)
DM 1108-01 2.5 Kg

SS Agar (Salmonella Shigella Agar)

Sign In for Pricing
View Details
SS Agar (Salmonella Shigella Agar)
DM 1108-02 5 Kg

SS Agar (Salmonella Shigella Agar)

Sign In for Pricing
View Details
SS Agar (Salmonella Shigella Agar)
DM 1108-03 100 g

SS Agar (Salmonella Shigella Agar)

Sign In for Pricing
View Details