Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Chloramphenicol acetyltransferase (cat)

This Recombinant Staphylococcus aureus Chloramphenicol acetyltransferase (cat) spans the amino acid sequence from region 1-215aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAT

UniProt

P06135

Expression Region

1-215aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTFNIIKLENWDRKEYFEHYFNQQTTYSITKEIDITLFKDMIKKKGYEIYPSLIYAIMEVVNKNKVFRTGINSENKLGYWDKLNPLYTVFNKQTEKFTNIWTESDNNFTSFYNNYKNDLFEYKDKEEMFPKKPIPENTIPISMIPWIDFSSFNLNIGNNSSFLLPIITIGKFYSENNKIYIPVALQLHHAVCDGYHASLFINEFQDIINKVDDWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIN3
332869 100 µL

RIN3

Sign In for Pricing
View Details
KR121 rabbit pAb
E44H15622 100 µL

KR121 rabbit pAb

Sign In for Pricing
View Details
PON1 Mouse Monoclonal Antibody (Fluoro550)
orb3085833 100 µg

PON1 Mouse Monoclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
LAT AAV Vector (Rat) (CMV)
26325106 1 µg

LAT AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Cytochrome C Polyclonal Antibody, FITC Conjugated
bs-0013R-FITC-TR 20 µL

Cytochrome C Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Trnp1 3'UTR Lenti-reporter-Luc Vector
48491086 1.0 µg

Trnp1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details