Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic (FTRC)

This Recombinant Arabidopsis thaliana Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic (FTRC) spans the amino acid sequence from region 32-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FTR-C; Ferredoxin-thioredoxin reductase subunit B; FTR-B

UniProt

Q9SJ89

Expression Region

32-146aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKTEPSEKSVEIMRKFSEQYARRSGTYFCVDKGVTSVVIKGLAEHKDSYGAPLCPCRHYDDKAAEVGQGFWNCPCVPMRERKECHCMLFLTPDNDFAGKDQTITSDEIKETTANM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant IKZF3 Antibody
RC-5760-01 50 μL

Recombinant IKZF3 Antibody

Sign In for Pricing
View Details
Recombinant IKZF3 Antibody
RC-5760-02 100 µL

Recombinant IKZF3 Antibody

Sign In for Pricing
View Details
Recombinant IKZF3 Antibody
RC-5760-03 1 mL

Recombinant IKZF3 Antibody

Sign In for Pricing
View Details
KLHL8 (NM_020803) Human Recombinant Protein
TP307372L 1 mg

KLHL8 (NM_020803) Human Recombinant Protein

Sign In for Pricing
View Details
Zinc Sulfate (Solution in Water)
TRC-Z439985-250ML 250 mL

Zinc Sulfate (Solution in Water)

Sign In for Pricing
View Details
ZNF778 Human Gene Knockout Kit (CRISPR)
KN419146 1 Kit

ZNF778 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details