Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Thioredoxin M1, chloroplastic

This Recombinant Arabidopsis thaliana Thioredoxin M1, chloroplastic (At1g03680) spans the amino acid sequence from region 49-179aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AtTrxm1

UniProt

O48737

Expression Region

49-179aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSSLSKNSRVSRLRRGVICEAQDTATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLATSINKFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angptl4 (NM_199115) Rat Tagged Lenti ORF Clone
RR211040L4 10 µg

Angptl4 (NM_199115) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mep1a Rat shRNA Plasmid (Locus ID 25684)
TL709734 1 Kit

Mep1a Rat shRNA Plasmid (Locus ID 25684)

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM128 Antibody [mFluor Violet 500 SE]
NBP2-98119MFV500 0.1 mL

Rabbit Polyclonal TMEM128 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
DGKE Protein Vector (Human) (pPM-C-His)
PV051348 500 ng

DGKE Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SLG1 Antibody
orb851193 2 mg

SLG1 Antibody

Sign In for Pricing
View Details
NDUFS1 Antibody, mAb, Rabbit
A04259-50 50 µL

NDUFS1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details