Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Small outer capsid protein (soc)

This Recombinant Enterobacteria phage T4 Small outer capsid protein (soc) spans the amino acid sequence from region 1-80aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Soc

UniProt

P03715

Expression Region

1-80aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASTRGYVNIKTFEQKLDGNKKIEGKEISVAFPLYSDVHKISGAHYQTFPSEKAAYSTVYEENQRTEWIAANEDLWKVTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atg9b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4690906 1.0 µg DNA

Atg9b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Arap3 Mouse qPCR Primer Pair (NM_139206)
MP202295 200 Reactions

Arap3 Mouse qPCR Primer Pair (NM_139206)

Sign In for Pricing
View Details
Anti-Smad2 Antibody Picoband®, Carrier-free
PA1898-carrier-free 100 µg/Vial

Anti-Smad2 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Recombinant Bordetella Parapertussis BPP1850 Protein (aa 1-225)
VAng-Lsx2590-50gEcoli 50 µg (E. coli)

Recombinant Bordetella Parapertussis BPP1850 Protein (aa 1-225)

Sign In for Pricing
View Details
MOCOS-set siRNA/shRNA/RNAi Lentivector (Human)
30291091 4x 500 ng

MOCOS-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Glutathione Peroxidase 8 (GPX8) Antibody (Biotin)
abx309974-01 20 µg

Glutathione Peroxidase 8 (GPX8) Antibody (Biotin)

Sign In for Pricing
View Details