Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Small outer capsid protein (soc)

This Recombinant Enterobacteria phage T4 Small outer capsid protein (soc) spans the amino acid sequence from region 1-80aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Soc

UniProt

P03715

Expression Region

1-80aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASTRGYVNIKTFEQKLDGNKKIEGKEISVAFPLYSDVHKISGAHYQTFPSEKAAYSTVYEENQRTEWIAANEDLWKVTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD87
553789 100 µg

CD87

Sign In for Pricing
View Details
Lentiviral mouse Zfp457 shRNA (UAS) - Lentiviral mouse Zfp457 shRNA (UAS, RFP) plasmid
GTR15259201 1 Vial

Lentiviral mouse Zfp457 shRNA (UAS) - Lentiviral mouse Zfp457 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit Sestrin 2 ELISA Kit
MBS103764 Inquire

Rabbit Sestrin 2 ELISA Kit

Sign In for Pricing
View Details
RRAGC CytoSection
TS403834P5 25 Slides

RRAGC CytoSection

Sign In for Pricing
View Details
AP2A1 Immunizing Peptide
MBS427834-01 0.1 mg

AP2A1 Immunizing Peptide

Sign In for Pricing
View Details
AP2A1 Immunizing Peptide
MBS427834-02 5x 0.1 mg

AP2A1 Immunizing Peptide

Sign In for Pricing
View Details