Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic (PSA2)

This Recombinant Oryza sativa subsp. japonica Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic (PSA2) spans the amino acid sequence from region 95-187aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6YUA8

Expression Region

95-187aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Oryza sativa subsp. japonica (Rice)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DMMSKPAVCRNCNGSGAVLCDMCGGTGKWKALNRKRAKDVYLFTECPNCYGRGKLVCPVCLGTGLPNNKGLLRRPDAKKLLDKMYNGKILPDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCKL1 Rabbit Polyclonal Antibody
TA383059 100 µL

UCKL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WSTF Recombinant Antibody
bsm-61926R-01 20 µL

WSTF Recombinant Antibody

Sign In for Pricing
View Details
WSTF Recombinant Antibody
bsm-61926R-02 100 µL

WSTF Recombinant Antibody

Sign In for Pricing
View Details
7-Nitro-3,4-dihydroisoquinolin-1 (2H) -one
XAA24596-01 2 g

7-Nitro-3,4-dihydroisoquinolin-1 (2H) -one

Sign In for Pricing
View Details
7-Nitro-3,4-dihydroisoquinolin-1 (2H) -one
XAA24596-02 5 g

7-Nitro-3,4-dihydroisoquinolin-1 (2H) -one

Sign In for Pricing
View Details
7-Nitro-3,4-dihydroisoquinolin-1 (2H) -one
XAA24596-03 10 g

7-Nitro-3,4-dihydroisoquinolin-1 (2H) -one

Sign In for Pricing
View Details