Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Fatty acid-binding protein 10-A, liver basic (fabp10a)

This Recombinant Danio rerio Fatty acid-binding protein 10-A, liver basic (fabp10a) spans the amino acid sequence from region 1-126aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zf-FABP10; Zf-Lb-FABP; Fatty acid-binding protein, liver; Liver bile acid-binding protein; L-BABP; z-L-BABP; Liver-type fatty acid-binding protein; L-FABP; Liver-type FABP

UniProt

Q9I8L5

Expression Region

1-126aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Neuroscience; Gastroenterology & Hepatology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFSGTWQVYAQENYEEFLRAISLPEEVIKLAKDVKPVTEIQQNGSDFTITSKTPGKTVTNSFTIGKEAEITTMDGKKLKCIVKLDGGKLVCRTDRFSHIQEIKAGEMVETLTVGGTTMIRKSKKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat A Disintegrin And Metalloprotease 9 ELISA kit
GTR10441924 96 Well

Rat A Disintegrin And Metalloprotease 9 ELISA kit

Sign In for Pricing
View Details
Mouse Splicing factor, arginine/serine-rich 4 (SRSF4) ELISA Kit
orb2811754-01 48 Tests

Mouse Splicing factor, arginine/serine-rich 4 (SRSF4) ELISA Kit

Sign In for Pricing
View Details
Mouse Splicing factor, arginine/serine-rich 4 (SRSF4) ELISA Kit
orb2811754-02 96 Tests

Mouse Splicing factor, arginine/serine-rich 4 (SRSF4) ELISA Kit

Sign In for Pricing
View Details
Mouse Splicing factor, arginine/serine-rich 4 (SRSF4) ELISA Kit
orb2811754-03 5 x 96 T

Mouse Splicing factor, arginine/serine-rich 4 (SRSF4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal MEFV Antibody [Allophycocyanin]
NBP2-80113APC 0.1 mL

Rabbit Polyclonal MEFV Antibody [Allophycocyanin]

Sign In for Pricing
View Details
ULK2 Antibody (C-term)
MBS9206270-01 0.08 mL

ULK2 Antibody (C-term)

Sign In for Pricing
View Details