Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Regakine-1

This Recombinant Bovine Regakine-1 spans the amino acid sequence from region 22-92aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P82943

Expression Region

22-92aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NEEPAGNMRVCCFSSVTRKIPLSLVKNYERTGDKCPQEAVIFQTRSGRSICANPGQAWVQKYIEYLDQMSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican 3 (GPC3) Human Gene Knockout Kit (CRISPR)
KN205911 1 Kit

Glypican 3 (GPC3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Kcnma1 Mouse Monoclonal Antibody [Clone ID: L6/60]
75-022 100 µL

Kcnma1 Mouse Monoclonal Antibody [Clone ID: L6/60]

Sign In for Pricing
View Details
TCF3 / E2A (TCF3) Rabbit Polyclonal Antibody
AP20520PU-N 100 µg

TCF3 / E2A (TCF3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WIN 64338 Hydrochloride
TRC-W498860-750MG 750 mg

WIN 64338 Hydrochloride

Sign In for Pricing
View Details
Runx3 Mouse Gene Knockout Kit (CRISPR)
KN515211 1 Kit

Runx3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FXYD7 (NM_022006) Human Recombinant Protein
TP305819L 1 mg

FXYD7 (NM_022006) Human Recombinant Protein

Sign In for Pricing
View Details