Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interleukin-17A (IL17A)

This Recombinant Bovine Interleukin-17A (IL17A) spans the amino acid sequence from region 24-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-17; IL-17A

UniProt

Q687Y7

Expression Region

24-153aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Dnmt1 (Ser714) Antibody
MBS9612760-01 0.1 mL

Phospho-Dnmt1 (Ser714) Antibody

Sign In for Pricing
View Details
Phospho-Dnmt1 (Ser714) Antibody
MBS9612760-02 0.2 mL

Phospho-Dnmt1 (Ser714) Antibody

Sign In for Pricing
View Details
Phospho-Dnmt1 (Ser714) Antibody
MBS9612760-03 5x 0.2 mL

Phospho-Dnmt1 (Ser714) Antibody

Sign In for Pricing
View Details
2-[ (2-Cyclopropyl-3-oxo-2,3-dihydro-1H-isoindol-1-yl) formamido]acetic acid
PYB66119-01 250 mg

2-[ (2-Cyclopropyl-3-oxo-2,3-dihydro-1H-isoindol-1-yl) formamido]acetic acid

Sign In for Pricing
View Details
2-[ (2-Cyclopropyl-3-oxo-2,3-dihydro-1H-isoindol-1-yl) formamido]acetic acid
PYB66119-02 2.5 g

2-[ (2-Cyclopropyl-3-oxo-2,3-dihydro-1H-isoindol-1-yl) formamido]acetic acid

Sign In for Pricing
View Details
CD276 Mouse Monoclonal Antibody
TD-30103 100 µL

CD276 Mouse Monoclonal Antibody

Sign In for Pricing
View Details