Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ferritin heavy chain (Fth1)

This Recombinant Mouse Ferritin heavy chain (Fth1) spans the amino acid sequence from region 1-182aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ferritin H subunit

UniProt

P09528

Expression Region

1-182aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLGHGDES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RUNX3 Rabbit Polyclonal Antibody
TA381194 100 µL

RUNX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Volinanserin Hydrochloride Salt
TRC-V755000-25MG 25 mg

Volinanserin Hydrochloride Salt

Sign In for Pricing
View Details
SCP3 (SYCP3) (NM_153694) Human Recombinant Protein
TP309340 20 µg

SCP3 (SYCP3) (NM_153694) Human Recombinant Protein

Sign In for Pricing
View Details
HSP40, YDJ1 Antibody: ATTO 488
SMC-166D-A488 100 µg

HSP40, YDJ1 Antibody: ATTO 488

Sign In for Pricing
View Details
Halogen Moisture analyzer BANA-503
BANA-503 1 Unit

Halogen Moisture analyzer BANA-503

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS651252 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details