Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-19 (IL19), Biotinylated

This Recombinant Human Interleukin-19 (IL19), Biotinylated spans the amino acid sequence from region 25-177aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-19; Melanoma differentiation-associated protein-like protein; NG.1

UniProt

Q9UHD0

Expression Region

25-177aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pisum sativum Gel -PSA- Immobilized Lectin
A-2701-2 2 mL

Pisum sativum Gel -PSA- Immobilized Lectin

Sign In for Pricing
View Details
ROR2 Mouse Monoclonal Antibody [Clone ID: OTI3F8]
CF810006 100 µg

ROR2 Mouse Monoclonal Antibody [Clone ID: OTI3F8]

Sign In for Pricing
View Details
SNX10 Mouse Monoclonal Antibody [Clone ID: OTI3D10]
CF808849 100 µg

SNX10 Mouse Monoclonal Antibody [Clone ID: OTI3D10]

Sign In for Pricing
View Details
SNTN (NM_001080537) Human Over-expression Lysate
LY421091 100 µg

SNTN (NM_001080537) Human Over-expression Lysate

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), Biotin conjugate, 0.1mg/mL
BNCB1860-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human C1orf19 (TSEN15) activation kit by CRISPRa
GA114598 1 Kit

Human C1orf19 (TSEN15) activation kit by CRISPRa

Sign In for Pricing
View Details