Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia phage MS2 Capsid protein

This Recombinant Escherichia phage MS2 Capsid protein spans the amino acid sequence from region 2-130aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CP; Coat protein

UniProt

P03612

Expression Region

2-130aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia phage MS2 (Bacteriophage MS2)

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mplkip shRNA (UAS) - Lentiviral mouse Mplkip shRNA (UAS, GFP) (100)
GTR15120741 1 Vial

Lentiviral mouse Mplkip shRNA (UAS) - Lentiviral mouse Mplkip shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human Monoclonal APP Antibody (Hu13) [FITC]
FAB9919F 0.1 mL

Human Monoclonal APP Antibody (Hu13) [FITC]

Sign In for Pricing
View Details
PRELI shRNA (m) Lentiviral Particles
sc-76243-V 200 µL

PRELI shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
PE/iFluor® 700 Anti-human CD169 Antibody *7-239*
116901U1-AAT 100 Tests

PE/iFluor® 700 Anti-human CD169 Antibody *7-239*

Sign In for Pricing
View Details
GDC-0032 50mg
A12831-50 50 mg

GDC-0032 50mg

Sign In for Pricing
View Details
Porcine beta-arrestin, ARRB GENLISA ELISA
KLP0098 96 Well

Porcine beta-arrestin, ARRB GENLISA ELISA

Sign In for Pricing
View Details