Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1)
Selected Variant
GTR19066116-01
Size: 20 µg
This Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1) spans the amino acid sequence from region 1-117aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Early estrogen-regulated protein; GABAA; Glandular epithelial cell protein 1; GEC-1
UniProt
Q9H0R8
Expression Region
1-117aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Pharmacology & Drug Discovery; Cell Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
14.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PB9955-Dylight488 100 µg
Anti-MUC3/MUC3A/MUC3B Antibody Picoband® (Dylight488 Conjugate)
Sign In for Pricing
View Details 
BNC882391-100 1x 100 µL
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040506-500 1x 500 µL
Estrogen Receptor (ER506), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Human Interferon gamma Recombinant Rabbit Monoclonal Antibody [PSH01-46] - BSA and Azide free (Capture)](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea8218d/imageurl/ha721684.webp)
HA721684 100 µL
Human Interferon gamma Recombinant Rabbit Monoclonal Antibody [PSH01-46] - BSA and Azide free (Capture)
Sign In for Pricing
View Details 
BNC682052-500 1x 500 µL
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041082-100 1x 100 µL
MHC II (HLA-DRA) (19-26.1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details