Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cyclic AMP-dependent transcription factor ATF-4 (Atf4)

This Recombinant Mouse Cyclic AMP-dependent transcription factor ATF-4 (Atf4) spans the amino acid sequence from region 1-349aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAMP-dependent transcription factor ATF-4; Activating transcription factor 4; C/EBP-related ATF; C/ATF; Cyclic AMP-responsive element-binding protein 2; CREB-2; cAMP-responsive element-binding protein 2

UniProt

Q06507

Expression Region

1-349aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWPAMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHPK Antibody - middle region (ARP77217_P050)
ARP77217_P050 100 µL

SHPK Antibody - middle region (ARP77217_P050)

Sign In for Pricing
View Details
M-Chlorophenylbiguanide hydrochloride
T22959-01 200 mg

M-Chlorophenylbiguanide hydrochloride

Sign In for Pricing
View Details
M-Chlorophenylbiguanide hydrochloride
T22959-02 500 mg

M-Chlorophenylbiguanide hydrochloride

Sign In for Pricing
View Details
M-Chlorophenylbiguanide hydrochloride
T22959-03 1 g

M-Chlorophenylbiguanide hydrochloride

Sign In for Pricing
View Details
ERCC1 Antibody
DF7255-01 100 µL

ERCC1 Antibody

Sign In for Pricing
View Details
ERCC1 Antibody
DF7255-02 200 µL

ERCC1 Antibody

Sign In for Pricing
View Details