Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial

This Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial spans the amino acid sequence from region 33-187aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CSF-1; MCSF

UniProt

P07141

Expression Region

33-187aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF113A2 CRISPR Activation Plasmid (m2)
sc-425983-ACT-2 20 µg

RNF113A2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
LOC687034 3'UTR GFP Stable Cell Line
TU261505 1.0 mL

LOC687034 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human IL-2 (C145S HEK293-expressed) Protein CF
11218-IL-250 250 µg

Recombinant Human IL-2 (C145S HEK293-expressed) Protein CF

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 19, FGF19 ELISA KIT
E1755Mo-01 48 Well

Mouse Fibroblast Growth Factor 19, FGF19 ELISA KIT

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 19, FGF19 ELISA KIT
E1755Mo-02 96 Well

Mouse Fibroblast Growth Factor 19, FGF19 ELISA KIT

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 19, FGF19 ELISA KIT
E1755Mo-03 5x 96 Tests

Mouse Fibroblast Growth Factor 19, FGF19 ELISA KIT

Sign In for Pricing
View Details