Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IgGFc-binding protein (FCGBP), partial

This Recombinant Human IgGFc-binding protein (FCGBP), partial spans the amino acid sequence from region 471-690aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fcgamma-binding protein antigen; FcgammaBP

UniProt

Q9Y6R7

Expression Region

471-690aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VCRAQGDPHYTTFDGRRYDMMGTCSYTMVELCSEDDTLPAFSVEAKNEHRGSRRVSYVGLVTVRAYSHSVSLTRGEVGFVLVDNQRSRLPVSLSEGRLRVYQSGPRAVVELVFGLVVTYDWDCQLALSLPARFQDQVCGLCGNYNGDPADDFLTPDGALAPDAVEFASSWKLDDGDYLCEDGCQNNCPACTPGQAQHYEGDRLCGMLTKLDGPFAVCHDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Got1 activation kit by CRISPRa
GA201679 1 Kit

Mouse Got1 activation kit by CRISPRa

Sign In for Pricing
View Details
Secretogranin 3 (SCG3) (NM_013243) Human Over-expression Lysate
LC402232 20 µg

Secretogranin 3 (SCG3) (NM_013243) Human Over-expression Lysate

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF594 conjugate, 0.1mg/mL
BNC943496-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IKB beta (NFKBIB) Rabbit Polyclonal Antibody
AP21089PU-N 100 µg

IKB beta (NFKBIB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADX Rabbit Polyclonal Antibody
HA500468 100 µL

ADX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Enfortumab Biosimilar - Research Grade
ICH5070-1mg 1 mg

Enfortumab Biosimilar - Research Grade

Sign In for Pricing
View Details