Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synapsin-1 (SYN1), partial

This Recombinant Human Synapsin-1 (SYN1), partial spans the amino acid sequence from region 113-420aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain protein 4.1; Synapsin I

UniProt

P17600

Expression Region

113-420aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C1orf187 (DRAXIN) (NM_198545) AAV Particle
RC210701A1V 250 µL

Human C1orf187 (DRAXIN) (NM_198545) AAV Particle

Sign In for Pricing
View Details
BACH1 Rabbit pAb
E47R4092 100 µL

BACH1 Rabbit pAb

Sign In for Pricing
View Details
HV1S sgRNA CRISPR Lentivector (Human) (Target 1)
K1007102 1.0 µg DNA

HV1S sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
hsa-miR-29b-2-5p Primers
MPH02390 150 µL / 10 µM

hsa-miR-29b-2-5p Primers

Sign In for Pricing
View Details
Prokaryotic Human Cathepsin D
RPU60983-01 50 µg

Prokaryotic Human Cathepsin D

Sign In for Pricing
View Details
Prokaryotic Human Cathepsin D
RPU60983-02 100 µg

Prokaryotic Human Cathepsin D

Sign In for Pricing
View Details