Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 (IL15)

This Recombinant Human Interleukin-15 (IL15) spans the amino acid sequence from region 49-162aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-15

UniProt

P40933

Expression Region

49-162aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), Biotin conjugate, 0.1mg/mL
BNCB1958-500 1x 500 µL

Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PON1/PON2 Antibody
KC-23587-01 50 μL

PON1/PON2 Antibody

Sign In for Pricing
View Details
PON1/PON2 Antibody
KC-23587-02 100 µL

PON1/PON2 Antibody

Sign In for Pricing
View Details
PON1/PON2 Antibody
KC-23587-03 1 mL

PON1/PON2 Antibody

Sign In for Pricing
View Details
Akt2 Mouse Gene Knockout Kit (CRISPR)
KN501101 1 Kit

Akt2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCUBE3 Human qPCR Primer Pair (NM_152753)
HP217943 200 Reactions

SCUBE3 Human qPCR Primer Pair (NM_152753)

Sign In for Pricing
View Details