Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 (IL15)

This Recombinant Human Interleukin-15 (IL15) spans the amino acid sequence from region 49-162aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-15

UniProt

P40933

Expression Region

49-162aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF568 conjugate, 0.1mg/mL
BNC680743-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FHL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E1]
TA501280BM 100 µL

FHL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E1]

Sign In for Pricing
View Details
Caveolin-1 (Ab-14) Antibody
8B7034-AAT 50 µg

Caveolin-1 (Ab-14) Antibody

Sign In for Pricing
View Details
ExoBriteTM 490/515 CD81 (Mouse/Rat) Flow Antibody (25 tests)
P019-490-125 1x 125 µL

ExoBriteTM 490/515 CD81 (Mouse/Rat) Flow Antibody (25 tests)

Sign In for Pricing
View Details
Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G10]
TA503415BM 100 µL

Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G10]

Sign In for Pricing
View Details
DYDC2 Rabbit Polyclonal Antibody
TA365300 100 µL

DYDC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details