Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional coactivator YAP1 (YAP1)

This Recombinant Human Transcriptional coactivator YAP1 (YAP1) spans the amino acid sequence from region 1-504aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Yes-associated protein 1; Protein yorkie homolog; Yes-associated protein YAP65 homolog

UniProt

P46937

Expression Region

1-504aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coelenterazine, native
TRC-C636000-5MG 5 mg

Coelenterazine, native

Sign In for Pricing
View Details
CD44 Standard (HCAM/918), Biotin conjugate, 0.1mg/mL
BNCB0918-100 1x 100 µL

CD44 Standard (HCAM/918), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Allylprodine Hydrochloride
TRC-A572300-1MG 1 mg

Allylprodine Hydrochloride

Sign In for Pricing
View Details
C1QTNF9 (NM_001303138) Human Tagged ORF Clone
RG237508 10 µg

C1QTNF9 (NM_001303138) Human Tagged ORF Clone

Sign In for Pricing
View Details
RTN4RL2 Antibody
KC-3753-01 50 μL

RTN4RL2 Antibody

Sign In for Pricing
View Details
RTN4RL2 Antibody
KC-3753-02 100 µL

RTN4RL2 Antibody

Sign In for Pricing
View Details