Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-23 subunit alpha (Il23a)

This Recombinant Mouse Interleukin-23 subunit alpha (Il23a) spans the amino acid sequence from region 22-196aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-23 subunit p19 Short name: IL-23p19

UniProt

Q9EQ14

Expression Region

22-196aa

Tag

C-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (dimethylamino) isonicotinaldehyde
OR1098548-01 250 mg

2- (dimethylamino) isonicotinaldehyde

Sign In for Pricing
View Details
2- (dimethylamino) isonicotinaldehyde
OR1098548-02 500 mg

2- (dimethylamino) isonicotinaldehyde

Sign In for Pricing
View Details
Slfn5 (NM_183201) Mouse Untagged Clone
MC222405 10 µg

Slfn5 (NM_183201) Mouse Untagged Clone

Sign In for Pricing
View Details
LCE3D (NM_032563) Human Tagged ORF Clone Lentiviral Particle
RC211021L4V 200 µL

LCE3D (NM_032563) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ESX1 Antibody
E38QA7407 100 µL

ESX1 Antibody

Sign In for Pricing
View Details
Rbms3 (NM_001172126) Mouse Tagged Lenti ORF Clone
MR217432L4 10 µg

Rbms3 (NM_001172126) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details