Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5F1D), partial

This Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5F1D), partial spans the amino acid sequence from region 43-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F-ATPase delta subunit

UniProt

P30049

Expression Region

43-161aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USB1 Antibody
orb2682548-01 50 µL

USB1 Antibody

Sign In for Pricing
View Details
USB1 Antibody
orb2682548-02 100 µL

USB1 Antibody

Sign In for Pricing
View Details
USB1 Antibody
orb2682548-03 200 µL

USB1 Antibody

Sign In for Pricing
View Details
Human Thrombospondin Type I Domain Containing Protein 7A ELISA Kit
IHUTHSD7AKT 1 Each

Human Thrombospondin Type I Domain Containing Protein 7A ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Rab32 shRNA (UAS) - Lentiviral mouse Rab32 shRNA (UAS, iRFP) (100)
GTR15255711 1 Vial

Lentiviral mouse Rab32 shRNA (UAS) - Lentiviral mouse Rab32 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-Collagen I/COL1A1 Antibody Picoband® (Dylight594 Conjugate)
PB9938-Dylight594 100 µg

Anti-Collagen I/COL1A1 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details