Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5F1D), partial

This Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5F1D), partial spans the amino acid sequence from region 43-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F-ATPase delta subunit

UniProt

P30049

Expression Region

43-161aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX7 (Paired Box 7, HUP1, PAX7B) (MaxLight 550)
249760-ML550 100 µL

PAX7 (Paired Box 7, HUP1, PAX7B) (MaxLight 550)

Sign In for Pricing
View Details
RILPL2 Double Nickase Plasmid (m2)
sc-429791-NIC-2 20 µg

RILPL2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Mfap3 ORF Vector (Mouse) (pORF)
ORF050126 1.0 µg DNA

Mfap3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ATP Synthase subunit s-Like protein (ATP5SL) Bovine ELISA Kit
B7269 96 Tests

ATP Synthase subunit s-Like protein (ATP5SL) Bovine ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat Uteroglobin/SCGB1A1 Protein
NBP2-61370-1000ug 1000 µg

Recombinant Rat Uteroglobin/SCGB1A1 Protein

Sign In for Pricing
View Details
Rabbit Polyclonal TMCO5 Antibody [DyLight 650]
NBP3-06174C 0.1 mL

Rabbit Polyclonal TMCO5 Antibody [DyLight 650]

Sign In for Pricing
View Details