Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5F1D), partial

This Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5F1D), partial spans the amino acid sequence from region 43-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F-ATPase delta subunit

UniProt

P30049

Expression Region

43-161aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD3 epsilon Protein, Fc Tag
orb348808-01 1 mg

Mouse CD3 epsilon Protein, Fc Tag

Sign In for Pricing
View Details
Mouse CD3 epsilon Protein, Fc Tag
orb348808-02 100 µg

Mouse CD3 epsilon Protein, Fc Tag

Sign In for Pricing
View Details
Lentiviral human SPANXD shRNA (UAS) - Lentiviral human SPANXD shRNA (UAS, GFP) plasmid
GTR15298741 1 Vial

Lentiviral human SPANXD shRNA (UAS) - Lentiviral human SPANXD shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Sodium Phosphate Monobasic
B2015199 100 g

Sodium Phosphate Monobasic

Sign In for Pricing
View Details
LINS Protein Vector (Mouse) (pPM-C-HA)
26867024 500 ng

LINS Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Olfr490 3'UTR Lenti-reporter-Luc Vector
33197084 1.0 µg

Olfr490 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details