Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 60S acidic ribosomal protein P2 (RPLP2), partial

This Recombinant Human 60S acidic ribosomal protein P2 (RPLP2), partial spans the amino acid sequence from region 1-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Renal carcinoma antigen NY-REN-44

UniProt

P05387

Expression Region

1-113aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACE Polyclonal Antibody
E44H04082 100 µL

BACE Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Heatr5b shRNA (UAS) - Lentiviral mouse Heatr5b shRNA (UAS, GFP) plasmid
GTR15237154 1 Vial

Lentiviral mouse Heatr5b shRNA (UAS) - Lentiviral mouse Heatr5b shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SLC9A3R2 Antibody
CSB-PA193846-01 50 μL

SLC9A3R2 Antibody

Sign In for Pricing
View Details
SLC9A3R2 Antibody
CSB-PA193846-02 100 µL

SLC9A3R2 Antibody

Sign In for Pricing
View Details
Anti-4E-BP1(Phospho-Thr45)
Y011223 100 µg

Anti-4E-BP1(Phospho-Thr45)

Sign In for Pricing
View Details
Recombinant Fremyella diplosiphon Allophycocyanin beta chain (apcB1)
MBS1247907-01 0.02 mg (E-Coli)

Recombinant Fremyella diplosiphon Allophycocyanin beta chain (apcB1)

Sign In for Pricing
View Details