Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Agouti-related protein (AGRP)

This Recombinant Human Agouti-related protein (AGRP) spans the amino acid sequence from region 83-132aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Agouti related neuropeptide; Agouti Related Protein Homolog; Agouti-related protein; Agrp; AGRP_HUMAN; AGRT; ART; ASIP2

UniProt

O00253

Expression Region

83-132aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stromal interaction molecule 1 (STIM1) Rabbit Polyclonal Antibody
TA382114 100 µL

Stromal interaction molecule 1 (STIM1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNF31 Antibody
KC-2605-01 50 μL

RNF31 Antibody

Sign In for Pricing
View Details
RNF31 Antibody
KC-2605-02 100 µL

RNF31 Antibody

Sign In for Pricing
View Details
RNF31 Antibody
KC-2605-03 1 mL

RNF31 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS513324 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
HLA Class II DR Mouse Monoclonal Antibody [Clone ID: MEM-12]
AM03101AC-N 100 Tests

HLA Class II DR Mouse Monoclonal Antibody [Clone ID: MEM-12]

Sign In for Pricing
View Details