Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Agouti-related protein (AGRP)

This Recombinant Human Agouti-related protein (AGRP) spans the amino acid sequence from region 83-132aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Agouti related neuropeptide; Agouti Related Protein Homolog; Agouti-related protein; Agrp; AGRP_HUMAN; AGRT; ART; ASIP2

UniProt

O00253

Expression Region

83-132aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), CF568 conjugate, 0.1mg/mL
BNC681631-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAPX1 (NKX3-2) (NM_001189) Human Over-expression Lysate
LY420079 100 µg

BAPX1 (NKX3-2) (NM_001189) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MPPE1 activation kit by CRISPRa
GA112253 1 Kit

Human MPPE1 activation kit by CRISPRa

Sign In for Pricing
View Details
CNOT4 (NM_001190848) Human Over-expression Lysate
LY434319 100 µg

CNOT4 (NM_001190848) Human Over-expression Lysate

Sign In for Pricing
View Details
Aff1 Mouse Gene Knockout Kit (CRISPR)
KN500955 1 Kit

Aff1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS636092 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details