Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-epidermal growth factor (EGF), partial

This Recombinant Human Pro-epidermal growth factor (EGF), partial spans the amino acid sequence from region 977-1023aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Urogastrone

UniProt

P01133

Expression Region

977-1023aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2L8 CRISPR/Cas9 KO Plasmid (h)
sc-417460 20 µg

OR2L8 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Rabbit Anti-ADCY9 antibody
SL3926R-01 50 µL

Rabbit Anti-ADCY9 antibody

Sign In for Pricing
View Details
Rabbit Anti-ADCY9 antibody
SL3926R-02 100 µL

Rabbit Anti-ADCY9 antibody

Sign In for Pricing
View Details
Ephrin-A1 (19-182, His-tag) Human Protein
AR50104PU-N 500 µg

Ephrin-A1 (19-182, His-tag) Human Protein

Sign In for Pricing
View Details
Branched Chain Aminotransferase 1, Cytosolic (BCAT1) Antibody
abx327549-01 50 µg

Branched Chain Aminotransferase 1, Cytosolic (BCAT1) Antibody

Sign In for Pricing
View Details
Branched Chain Aminotransferase 1, Cytosolic (BCAT1) Antibody
abx327549-02 100 µg

Branched Chain Aminotransferase 1, Cytosolic (BCAT1) Antibody

Sign In for Pricing
View Details