Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-epidermal growth factor (EGF), partial

This Recombinant Human Pro-epidermal growth factor (EGF), partial spans the amino acid sequence from region 977-1023aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Urogastrone

UniProt

P01133

Expression Region

977-1023aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALG1L (NM_001015050) Human Over-expression Lysate
LS200810 100 µg

ALG1L (NM_001015050) Human Over-expression Lysate

Sign In for Pricing
View Details
RSRC1 (NM_001271834) Human Tagged ORF Clone
RC233622 10 µg

RSRC1 (NM_001271834) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Aminopeptidase PILS/ARTS1 Antibody [FITC]
NBP2-41232F 0.1 mL

Rabbit Polyclonal Aminopeptidase PILS/ARTS1 Antibody [FITC]

Sign In for Pricing
View Details
DYX1C1 (Dyslexia Susceptibility 1 Candidate Gene 1 Protein, EKN1, FLJ37882, MGC70618, RD) (MaxLight 750) discontinued
126108-ML750 100 µL

DYX1C1 (Dyslexia Susceptibility 1 Candidate Gene 1 Protein, EKN1, FLJ37882, MGC70618, RD) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Huntingtin recombinant monoclonal antibody
A5933 100ul X 3

Huntingtin recombinant monoclonal antibody

Sign In for Pricing
View Details
NCRNA00266 3'UTR Luciferase Stable Cell Line
TU015439 1.0 mL

NCRNA00266 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details