Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adiponectin (Adipoq), partial

This Recombinant Mouse Adiponectin (Adipoq), partial spans the amino acid sequence from region 104-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

30KDA adipocyte complement-related protein; Adipocyte complement-related 30KDA protein ; ACRP30Adipocyte, C1q and collagen domain-containing protein; Adipocyte-specific protein AdipoQ

UniProt

Q60994

Expression Region

104-247aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R14C CRISPR Knock Out 293T Cell Line (Human)
37417141 1x 10^6 Cells / 1.0 mL

PPP1R14C CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
4-Chlorobenzenesulfonamide
591645 25.0g

4-Chlorobenzenesulfonamide

Sign In for Pricing
View Details
Plant Noggin (NOG) ELISA Kit
MBS9376881 Inquire

Plant Noggin (NOG) ELISA Kit

Sign In for Pricing
View Details
8430419L09Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)
10862094 4x 500 ng

8430419L09Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
4-Chloro-5-methoxy-2- (methylthio) pyrimidine
267604-01 250 mg

4-Chloro-5-methoxy-2- (methylthio) pyrimidine

Sign In for Pricing
View Details
4-Chloro-5-methoxy-2- (methylthio) pyrimidine
267604-02 500 mg

4-Chloro-5-methoxy-2- (methylthio) pyrimidine

Sign In for Pricing
View Details