Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oncostatin-M (OSM)

This Recombinant Human Oncostatin-M (OSM) spans the amino acid sequence from region 26-220aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MGC20461; ONCM_HUMAN; Oncostatin M; Oncostatin-M; OSM

UniProt

P13725

Expression Region

26-220aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Tau (Ser214/T217) Signaling Antibody Sampler Kit
CST 89892T 1 Kit

Phospho-Tau (Ser214/T217) Signaling Antibody Sampler Kit

Sign In for Pricing
View Details
ZnT-8 Rabbit Polyclonal Antibody
APRab20301-01 20 µL

ZnT-8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZnT-8 Rabbit Polyclonal Antibody
APRab20301-02 50 µL

ZnT-8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZnT-8 Rabbit Polyclonal Antibody
APRab20301-03 100 µL

ZnT-8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZnT-8 Rabbit Polyclonal Antibody
APRab20301-04 200 µL

ZnT-8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADAMTS1 Antibody
A60174-50UL 50 μL

ADAMTS1 Antibody

Sign In for Pricing
View Details