Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD320 antigen (CD320), partial

This Recombinant Human CD320 antigen (CD320), partial spans the amino acid sequence from region 36-231aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

8D6 antigenFDC-signaling molecule 8D6 ; FDC-SM-8D6Transcobalamin receptor ; TCblR; ; CD320

UniProt

Q9NPF0

Expression Region

36-231aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CellExp™Flt-3 / Flk-2, Fc Tag, Human Recombinant
P1459-10 10 µg

Human CellExp™Flt-3 / Flk-2, Fc Tag, Human Recombinant

Sign In for Pricing
View Details
Anti-ERP72 Antibody, Rabbit Polyclonal
MBS8119431-01 0.1 mL

Anti-ERP72 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-ERP72 Antibody, Rabbit Polyclonal
MBS8119431-02 5x 0.1 mL

Anti-ERP72 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
CD138 (Syndecan 1) (MaxLight 405) discontinued
C2548-63-ML405 100 µL

CD138 (Syndecan 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
EFHA2 Rabbit Polyclonal Antibody (BF555)
orb2513858 100 µL

EFHA2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
JDP2 siRNA (Mouse)
orb1839161-01 15 nmol

JDP2 siRNA (Mouse)

Sign In for Pricing
View Details