Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Wilms tumor protein (WT1), partial

This Recombinant Human Wilms tumor protein (WT1), partial spans the amino acid sequence from region 1-299aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

WT33

UniProt

P19544

Expression Region

1-299aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actl10 Mouse Gene Knockout Kit (CRISPR)
KN500777 1 Kit

Actl10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Chloro-5-nitrobenzoic Acid
TRC-C374055-500G 500 g

2-Chloro-5-nitrobenzoic Acid

Sign In for Pricing
View Details
ZNF705B Human Gene Knockout Kit (CRISPR)
KN430798 1 Kit

ZNF705B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2819R), CF647 conjugate, 0.1mg/mL
BNC472819-500 1x 500 µL

Cytokeratin 18 (KRT18) (KRT18/2819R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS621853 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Nectin 3 (NECTIN3) (C-term) Rabbit Polyclonal Antibody
AP53524PU-N 400 µL

Nectin 3 (NECTIN3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details