Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Wilms tumor protein (WT1), partial

This Recombinant Human Wilms tumor protein (WT1), partial spans the amino acid sequence from region 1-299aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

WT33

UniProt

P19544

Expression Region

1-299aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DDAH2 Antibody (R1G74)
RHB77701 100 μg

Anti-DDAH2 Antibody (R1G74)

Sign In for Pricing
View Details
Anti-CD10 [FR4D11]
orb758915 0.2 mg

Anti-CD10 [FR4D11]

Sign In for Pricing
View Details
TBX21, NT (TBX21, TBET, TBLYM, T-box transcription factor TBX21, T-cell-specific T-box transcription factor T-bet, Transcription factor TBLYM) (FITC)
MBS6354197-01 0.2 mL

TBX21, NT (TBX21, TBET, TBLYM, T-box transcription factor TBX21, T-cell-specific T-box transcription factor T-bet, Transcription factor TBLYM) (FITC)

Sign In for Pricing
View Details
TBX21, NT (TBX21, TBET, TBLYM, T-box transcription factor TBX21, T-cell-specific T-box transcription factor T-bet, Transcription factor TBLYM) (FITC)
MBS6354197-02 5x 0.2 mL

TBX21, NT (TBX21, TBET, TBLYM, T-box transcription factor TBX21, T-cell-specific T-box transcription factor T-bet, Transcription factor TBLYM) (FITC)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable cytochrome P450 513D1 (cyp513D1), partial
MBS1425870 Inquire

Recombinant Dictyostelium discoideum Probable cytochrome P450 513D1 (cyp513D1), partial

Sign In for Pricing
View Details
Merlin, phosphorylated (S518) (Merlin, Moesin-ezrin-radixin-like Protein, Neurofibromin-2, Schwannomerlin, Schwannomin, NF2, SCH) discontinued
224158-01 50 µL

Merlin, phosphorylated (S518) (Merlin, Moesin-ezrin-radixin-like Protein, Neurofibromin-2, Schwannomerlin, Schwannomin, NF2, SCH) discontinued

Sign In for Pricing
View Details