Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Urokinase-type plasminogen activator (PLAU), partial

This Recombinant Human Urokinase-type plasminogen activator (PLAU), partial spans the amino acid sequence from region 21-173aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATF; ATF uPA; BDPLT5; Plasminogen activator; Plasminogen activator urinary; Plasminogen activator urokinase; PLAU; QPD; u PA; U plasminogen activator; u-PA; U-plasminogen activator; uPA; URK; UROK_HUMAN; Urokinase plasminogen activator; Urokinase type plasminogen activator; Urokinase type plasminogen activator precursor; Urokinase-type plasminogen activator chain B

UniProt

P00749

Expression Region

21-173aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Mouse IgM, κ Isotype Control
RD22338F-01 25 µg

APC Mouse IgM, κ Isotype Control

Sign In for Pricing
View Details
APC Mouse IgM, κ Isotype Control
RD22338F-02 100 µg

APC Mouse IgM, κ Isotype Control

Sign In for Pricing
View Details
Rabbit IgG Mouse Monoclonal Antibody [Clone ID: OTI7B7]
CF815442 100 µg

Rabbit IgG Mouse Monoclonal Antibody [Clone ID: OTI7B7]

Sign In for Pricing
View Details
GGT1 (NM_001032364) Human Over-expression Lysate
LY422308 100 µg

GGT1 (NM_001032364) Human Over-expression Lysate

Sign In for Pricing
View Details
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]
TA501413AM 100 µL

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]

Sign In for Pricing
View Details
Slc35d2 Mouse Gene Knockout Kit (CRISPR)
KN516066 1 Kit

Slc35d2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details