Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Urokinase-type plasminogen activator (PLAU), partial

This Recombinant Human Urokinase-type plasminogen activator (PLAU), partial spans the amino acid sequence from region 21-173aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATF; ATF uPA; BDPLT5; Plasminogen activator; Plasminogen activator urinary; Plasminogen activator urokinase; PLAU; QPD; u PA; U plasminogen activator; u-PA; U-plasminogen activator; uPA; URK; UROK_HUMAN; Urokinase plasminogen activator; Urokinase type plasminogen activator; Urokinase type plasminogen activator precursor; Urokinase-type plasminogen activator chain B

UniProt

P00749

Expression Region

21-173aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH3 (Divergent Upstream Protein, DNA Mismatch Repair Protein, DNA Mismatch Repair Protein Msh 3, DNA Mismatch Repair Protein Msh3, DUC 1, DUC1, DUG, DUP, HMSH3, Mismatch Repair Protein 1, MRP 1, MRP1, MSH 3, MSH3_HUMAN, MutS Homolog 3 (E. coli), MutS Homolog 3)
324482-01 50 µL

MSH3 (Divergent Upstream Protein, DNA Mismatch Repair Protein, DNA Mismatch Repair Protein Msh 3, DNA Mismatch Repair Protein Msh3, DUC 1, DUC1, DUG, DUP, HMSH3, Mismatch Repair Protein 1, MRP 1, MRP1, MSH 3, MSH3_HUMAN, MutS Homolog 3 (E. coli), MutS Homolog 3)

Sign In for Pricing
View Details
MSH3 (Divergent Upstream Protein, DNA Mismatch Repair Protein, DNA Mismatch Repair Protein Msh 3, DNA Mismatch Repair Protein Msh3, DUC 1, DUC1, DUG, DUP, HMSH3, Mismatch Repair Protein 1, MRP 1, MRP1, MSH 3, MSH3_HUMAN, MutS Homolog 3 (E. coli), MutS Homolog 3)
324482-02 100 µL

MSH3 (Divergent Upstream Protein, DNA Mismatch Repair Protein, DNA Mismatch Repair Protein Msh 3, DNA Mismatch Repair Protein Msh3, DUC 1, DUC1, DUG, DUP, HMSH3, Mismatch Repair Protein 1, MRP 1, MRP1, MSH 3, MSH3_HUMAN, MutS Homolog 3 (E. coli), MutS Homolog 3)

Sign In for Pricing
View Details
XFD488 Anti-human CD45 Antibody *HI30*
10450151-AAT 500 Tests

XFD488 Anti-human CD45 Antibody *HI30*

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Probable CPS biosynthesis glycosyltransferase, partial
MBS7080157 Inquire

Recombinant Klebsiella pneumoniae Probable CPS biosynthesis glycosyltransferase, partial

Sign In for Pricing
View Details
2-Methoxy-4- (methylthio) pyridine-5-boronic acid
OR1083739 1 Each

2-Methoxy-4- (methylthio) pyridine-5-boronic acid

Sign In for Pricing
View Details
Her2 (ERBB2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7C2]
TA505883BM 100 µL

Her2 (ERBB2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7C2]

Sign In for Pricing
View Details