Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Angiogenin-1 (ANG1)

This Recombinant Bovine Angiogenin-1 (ANG1) spans the amino acid sequence from region 24-148aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ANG1; ANGAngiogenin-1; EC 3.1.27.-

UniProt

P10152

Expression Region

24-148aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMKNRRLTRPCKDRNTFIHGNKNDIKAICEDRNGQPYRGDLRISKSEFQITICKHKGGSSRPPCRYGATEDSRVIVVGCENGLPVHFDESFITPRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX5 (NM_006940) Human Over-expression Lysate
LY402064 100 µg

SOX5 (NM_006940) Human Over-expression Lysate

Sign In for Pricing
View Details
YIF1B (NM_001039673) Human Over-expression Lysate
LC422110 20 µg

YIF1B (NM_001039673) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human TNFRSF1B/CD120b Protein (aa 288-461, His Tag)
PKSH033161-01 10 µg

Recombinant Human TNFRSF1B/CD120b Protein (aa 288-461, His Tag)

Sign In for Pricing
View Details
Recombinant Human TNFRSF1B/CD120b Protein (aa 288-461, His Tag)
PKSH033161-02 50 µg

Recombinant Human TNFRSF1B/CD120b Protein (aa 288-461, His Tag)

Sign In for Pricing
View Details
Setdb2 Mouse Gene Knockout Kit (CRISPR)
KN515633 1 Kit

Setdb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FMNL2 (NM_052905) Human Recombinant Protein
TP319109 20 µg

FMNL2 (NM_052905) Human Recombinant Protein

Sign In for Pricing
View Details