Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Caspase-7 (CASP7), partial

This Recombinant Human Caspase-7 (CASP7), partial spans the amino acid sequence from region 24-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apoptotic protease Mch-3CMH-1ICE-like apoptotic protease 3 ; ICE-LAP3

UniProt

P55210

Expression Region

24-198aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-c-Yes YES1 Monoclonal Antibody
M02640 100 µL

Anti-c-Yes YES1 Monoclonal Antibody

Sign In for Pricing
View Details
Cytomegalovirus, Strain AD 169 (CMV) (MaxLight 405) discontinued
C9100-11-ML405 100 µL

Cytomegalovirus, Strain AD 169 (CMV) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Porcine Keratin 18 ELISA Kit
MBS107577-01 48 Well

Porcine Keratin 18 ELISA Kit

Sign In for Pricing
View Details
Porcine Keratin 18 ELISA Kit
MBS107577-02 96 Well

Porcine Keratin 18 ELISA Kit

Sign In for Pricing
View Details
Porcine Keratin 18 ELISA Kit
MBS107577-03 5x 96 Well

Porcine Keratin 18 ELISA Kit

Sign In for Pricing
View Details
Porcine Keratin 18 ELISA Kit
MBS107577-04 10x 96 Well

Porcine Keratin 18 ELISA Kit

Sign In for Pricing
View Details