Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Caspase-7 (CASP7), partial

This Recombinant Human Caspase-7 (CASP7), partial spans the amino acid sequence from region 207-303aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apoptotic protease Mch-3CMH-1ICE-like apoptotic protease 3 ; ICE-LAP3

UniProt

P55210

Expression Region

207-303aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti-Hepatitis B core (anti-HBcAg) IgM ELISA kit, 96 tests, Quantitative
4565 1 Kit

Human Anti-Hepatitis B core (anti-HBcAg) IgM ELISA kit, 96 tests, Quantitative

Sign In for Pricing
View Details
HMGN4 Antibody
A25356-100UL 100 µL

HMGN4 Antibody

Sign In for Pricing
View Details
Caspase-3 Recombinant Rabbit Monoclonal Antibody (PE)
orb2353269 100 µL

Caspase-3 Recombinant Rabbit Monoclonal Antibody (PE)

Sign In for Pricing
View Details
SLITRK2 CRISPR Activation Plasmid (m2)
sc-434134-ACT-2 20 µg

SLITRK2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)
MBS7007035-01 0.02 mg

Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)
MBS7007035-02 0.1 mg

Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)

Sign In for Pricing
View Details