Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Trehalose-phosphatase (TPS2), partial

This Recombinant Saccharomyces cerevisiae Trehalose-phosphatase (TPS2), partial spans the amino acid sequence from region 703-895aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Trehalose synthase complex catalytic subunit TPS2Trehalose-6-phosphate phosphatase ; TPP

UniProt

P31688

Expression Region

703-895aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GEFHAKELKEKLLSFTDDFDLEVMDGKANIEVRPRFVNKGEIVKRLVWHQHGKPQDMLKGISEKLPKDEMPDFVLCLGDDFTDEDMFRQLNTIETCWKEKYPDQKNQWGNYGFYPVTVGSASKKTVAKAHLTDPQQVLETLGLLVGDVSLFQSAGTVDLDSRGHVKNSESSLKSKLASKAYVMKRSASYTGAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Probable hydrolase PNKD (PNKD) Rabbit Polyclonal Antibody
TA362655 100 µL

Probable hydrolase PNKD (PNKD) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H2B Rabbit Polyclonal Antibody
HA500381 100 µL

Histone H2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-410
BCPS-410 1 Unit

Large Capacity Water Purification System BCPS-410

Sign In for Pricing
View Details
Ethyl 4-Chlorobutyrate
TRC-E901830-10G 10 g

Ethyl 4-Chlorobutyrate

Sign In for Pricing
View Details
Vacuum Oven BOVA-302
BOVA-302 1 Unit

Vacuum Oven BOVA-302

Sign In for Pricing
View Details
RAD51 (NM_001164270) Human Over-expression Lysate
LC431240 20 µg

RAD51 (NM_001164270) Human Over-expression Lysate

Sign In for Pricing
View Details