Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc transporter ZIP1 (SLC39A1), partial

This Recombinant Human Zinc transporter ZIP1 (SLC39A1), partial spans the amino acid sequence from region 126-179aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 39 member 1Zinc-iron-regulated transporter-likeZrt- and Irt-like protein 1 ; ZIP-1 ; hZIP1

UniProt

Q9NY26

Expression Region

126-179aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Fluoro-5-bromopyridine
TRC-F588785-10G 10 g

2-Fluoro-5-bromopyridine

Sign In for Pricing
View Details
Recombinant human VEGFR1 protein, C-His (HEK293)
bs-41611P-01 20 µg

Recombinant human VEGFR1 protein, C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human VEGFR1 protein, C-His (HEK293)
bs-41611P-02 100 µg

Recombinant human VEGFR1 protein, C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human VEGFR1 protein, C-His (HEK293)
bs-41611P-03 500 µg

Recombinant human VEGFR1 protein, C-His (HEK293)

Sign In for Pricing
View Details
JMJD2B Rabbit mAb
C05492-01 20 µL

JMJD2B Rabbit mAb

Sign In for Pricing
View Details
JMJD2B Rabbit mAb
C05492-02 100 µL

JMJD2B Rabbit mAb

Sign In for Pricing
View Details